PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G411300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 278aa    MW: 30943.5 Da    PI: 5.7132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G411300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181257147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W+++Ed +l ++v+++G+++W+ I++ ++ gR++k+c++rw + 
  Aqcoe1G411300.1.p 12 KGSWSPDEDARLTKLVEEHGPRNWSVISSGIP-GRSGKSCRLRWCNQ 57
                       799*****************************.***********985 PP

2Myb_DNA-binding54.62.5e-1766108347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++++ Ed ++++a++ +G++ W+tIar ++ gRt++ +k++w++ 
  Aqcoe1G411300.1.p  66 PFSPSEDAIIIKAHANHGNK-WATIARLLP-GRTDNAIKNHWNST 108
                        79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.666762IPR017930Myb domain
SuperFamilySSF466891.46E-2910105IPR009057Homeodomain-like
SMARTSM007176.3E-161160IPR001005SANT/Myb domain
PfamPF002496.4E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-231365IPR009057Homeodomain-like
CDDcd001676.95E-141456No hitNo description
SMARTSM007171.5E-1463111IPR001005SANT/Myb domain
PROSITE profilePS5129421.07363113IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-2366112IPR009057Homeodomain-like
CDDcd001674.27E-1166109No hitNo description
PfamPF002499.3E-1566108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVGMNGGDQR IKGSWSPDED ARLTKLVEEH GPRNWSVISS GIPGRSGKSC RLRWCNQLSP  60
LVQHRPFSPS EDAIIIKAHA NHGNKWATIA RLLPGRTDNA IKNHWNSTLR RRRLGLESSS  120
ASSDHDSESV TDSRKRQCIR VMSPEEDDDD DDDDEDEGLM EPVTSLSLSL PGKKSSAVRN  180
SDEGGKGEKV SSEIRNLGQK EEKAGRYEGE IKEMCLMTIM HRMIAEEVRN YMDKKLSQGS  240
LVAGIESEVR NYMERKLSEG NLGADEFESA GKEKDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-38111123104MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-371111257158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-371111257158MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-38111123104C-Myb DNA-Binding Domain
1msf_C5e-38111123104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253806.11e-101PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-55MYB44_ARATH; Transcription factor MYB44
TrEMBLW9SFX53e-84W9SFX5_9R
STRINGVIT_13s0067g01360.t016e-78(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-50myb domain protein 73